PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA44G00405
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 933aa    MW: 104228 Da    PI: 5.1221
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA44G00405genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.18.6e-183682148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEde l +av+ + g++Wk+Ia+++   Rt+ qc +rwqk+l
       AA44G00405 36 RGQWTAEEDEVLRKAVHSFNGKNWKKIAEYFK-DRTDVQCLHRWQKVL 82
                     89*****************************9.************986 PP

2Myb_DNA-binding59.66.7e-1988134148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd++++++v + G++ W+tIar+++ gR +kqc++rw+++l
       AA44G00405  88 KGPWTKEEDDKIIELVGEIGPKKWSTIARYLP-GRIGKQCRERWHNHL 134
                      79******************************.*************97 PP

3Myb_DNA-binding43.38.2e-14140182145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT+eE++ l++a++++G++ W+   + ++ gR+++ +k++w+
       AA44G00405 140 KEAWTQEEELVLIRAHQLYGNR-WAELTKFLP-GRSDNGIKNHWH 182
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.7163182IPR017930Myb domain
SuperFamilySSF466891.0E-153389IPR009057Homeodomain-like
SMARTSM007171.1E-143584IPR001005SANT/Myb domain
PfamPF002491.5E-153682IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-223790IPR009057Homeodomain-like
CDDcd001673.29E-133982No hitNo description
PROSITE profilePS5129431.66183138IPR017930Myb domain
SuperFamilySSF466897.49E-3085181IPR009057Homeodomain-like
SMARTSM007173.5E-1787136IPR001005SANT/Myb domain
PfamPF002492.7E-1788134IPR001005SANT/Myb domain
CDDcd001671.45E-1490134No hitNo description
Gene3DG3DSA:1.10.10.603.0E-2691137IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.2E-20138189IPR009057Homeodomain-like
SMARTSM007171.4E-12139187IPR001005SANT/Myb domain
PROSITE profilePS5129418.314139189IPR017930Myb domain
PfamPF002494.8E-12140182IPR001005SANT/Myb domain
CDDcd001671.17E-9142182No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0032875Biological Processregulation of DNA endoreduplication
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 933 aa     Download sequence    Send to blast
MEGDCTPSLT PPEGLIDANQ RSRHGRTTGP ARRSTRGQWT AEEDEVLRKA VHSFNGKNWK  60
KIAEYFKDRT DVQCLHRWQK VLNPELVKGP WTKEEDDKII ELVGEIGPKK WSTIARYLPG  120
RIGKQCRERW HNHLNPAINK EAWTQEEELV LIRAHQLYGN RWAELTKFLP GRSDNGIKNH  180
WHSSVKKKLE SYVSSGLLDQ CQTLPLTPYE RSSMLPSAVM QRTIDENGCL SVNSENCQNS  240
SMVGSSLSAS DYPNQVINIG HHFQNSQENE QAASVTYQTD QYFYPDLEDI SISISDISYD  300
MEDCSQFTDH NVATSSSQDY QFDIQELSDI SHEMTQNTSD VPIPYTKDSK KESNNSANEM  360
IPDTECCRVL FQDQESEGIS ASKSLTQEPN EVDQADYQDP TLCASASDNQ RSESTKSPLQ  420
SCSSRSIATA ASGKETLRPA PLIISPDKHA NETSSRLIFH PSAATPKRRA NANGSFICTG  480
DPSSSTCGDQ DNNNSSQQDQ SYRVSDSKKL VAVNDFASLA EVKEHSRPDH QPNMTNQQHH  540
EDMDASSLCF PSLDLPVFSS DLLQSKNDLL QDYSPLGIRK LLMSTVTCMS PLRLWESPTG  600
KKTLVGKQSI LKKRTRDLLT PISEKRSDKK LEIDIAASLA NDFSRLEVMF DESCDRESIS  660
GEKTSVNLGE NHHQTFNEDD EESWRMKPSR KSLEKAEQTS MEEHAKGNDD SEPDVVHTES  720
LSGVLAEHNT NKLELTTPSK SVTKSVKGQG STPRNHLQRT LIATSNKEGL CLVLNSPSRT  780
RNTEEINHEN FSIFCGTPFR RGLESPSAWK SPFYMNSLLP SPRFNTDITI EDIGYIFSPG  840
ERSYNGGGPM TDNNNNEAAQ AAADALADIM EFSGSIILRE DKMKQKELNK ENDEPTMTER  900
RVLDFDCLSP TKPTNSSETS IAAVSSSSSS LKG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C3e-66361896159MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-66361896159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00505DAPTransfer from AT5G11510Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3719750.0AF371975.2 Arabidopsis thaliana putative c-myb-like transcription factor MYB3R-4 (MYB3R4) mRNA, complete cds.
GenBankAY5196500.0AY519650.1 Arabidopsis thaliana MYB transcription factor (At5g11510) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006399657.10.0hypothetical protein EUTSA_v10012583mg
TrEMBLA0A087G6B10.0A0A087G6B1_ARAAL; Myb-related protein 3r-1-like
STRINGAT5G11510.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM132131828
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.10.0myb domain protein 3r-4